missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ GMPS Recombinant Protein Antigen
Alle ansehen Bio Techne Produkte
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Beschreibung
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GMPS. Source: E.coli Amino Acid Sequence: AGGDLKDGHHHYEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLT The GMPS Recombinant Protein Antigen is derived from E. coli. The GMPS Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Spezifikation
Spezifikation
| Gene ID (Entrez) | 8833 |
| Reinigungsverfahren | >80% by SDS-PAGE and Coomassie blue staining |
| Gebräuchliche Bezeichnung | GMPS Recombinant Protein Antigen |
| Inhalt und Lagerung | Store at −20°C. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS and 1M Urea, pH 7.4. |
| Zur Verwendung mit (Anwendung) | Blocking/Neutralizing, Control |
| Gen-Alias | EC 6.3.5.2, Glutamine amidotransferase, GMP synthase, GMP synthase [glutamine-hydrolyzing], GMP synthetase, guanine monphosphate synthetase, guanosine 5'-monophosphate synthase, MLL/GMPS fusion protein |
| Gensymbol | GMPS |
| Markertyp | Unmarkiert |
| Produkttyp | Recombinant Protein Antigen |
| Mehr anzeigen |
Nur für Forschungszwecke.
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur