missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemische Reagenzien
  4. Peptide
  5. 18010199

Novus Biologicals™ Glutamate Rich 5 Recombinant Protein Antigen

Codice prodotto. 18010199 Sfoglia Tutto Bio Techne Prodotti
missing translation for 'changeView'
missing translation for 'orderingAttributeHoverText'
Menge:
0,1 mL
missing translation for 'unitSize'
0.10 Milliliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Menge unitSize
18010199 0,1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 missing translation for 'options'
Questo articolo non è restituibile. Consulta la politica di reso
Codice prodotto. 18010199 missing translation for 'mfr' Novus Biologicals™ missing translation for 'supplierNo' NBP193788PEP

Please to purchase this item. Need a web account? Register with us today!

Questo articolo non è restituibile. Consulta la politica di reso

Descrizione

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C8orf47. The Glutamate Rich 5 Recombinant Protein Antigen is derived from E. coli. The Glutamate Rich 5 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-93788. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifica

Gene ID (Entrez) 203111
Spezies Human
Reinigungsverfahren Chromatography
Reinheit >80%
Konzentration 0.5mg/mL
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Zusammensetzung PBS and 1M Urea, pH 7.4.
Zur Verwendung mit (Anwendung) Blocking/Neutralizing, Control
Gensymbol C8orf47
Markertyp Unmarkiert
Molekulargewicht 26kDa
Produkttyp C8orf47
Menge 0,1 mL
Kennzeichnung RUO
Quelle E.Coli
Spezifische Reaktivität This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-93788. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen QPQGTVGKDEQAPLLETISKENESPEILEGSQFVETAEEQQLQATLGKEEQPQLLERIPKENVTPEVLDRSQLVEK
Vedi altri risultati Mostra meno risultati

Nur für Forschungszwecke

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.