missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. GDF-15 Antibody, Novus Biologicals™

GDF-15 Antibody, Novus Biologicals™

Artikelnummer. 18447830 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
25ul
Packungsgröße:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18447830 25ul 25 Mikroliter
18751534 - 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18447830 Lieferant Novus Biologicals Lieferanten-Nr. NBP18105025ul

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody has been used in 9 publications

GDF-15 Polyclonal specifically detects GDF-15 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Knockdown Validated.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen GDF-15
Anwendungen Immunoprecipitation, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunoprecipitation Reactivity reported in (PMID: 26114631)., Immunohistochemistry-Paraffin 1:50 - 1:200
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gen-Zugriffsnummer Q99988
Gen-Alias growth differentiation factor 15, growth/differentiation factor 15, Macrophage inhibitory cytokine 1, MIC-1NSAID-activated gene 1 protein, MIC1Prostate differentiation factor, NAG-1NSAID-regulated gene 1 protein, NSAID (nonsteroidal inflammatory drug)-activated protein 1, PDFGDF-15, PLABNRG-1, Placental bone morphogenetic protein, Placental TGF-beta, PTGFBPTGF-beta
Gensymbole GDF15
Wirtsspezies Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQL
Molekulargewicht des Antigens 34 kDa
Reinigungsverfahren Affinity Purified
Menge 25ul
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 9518
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.