missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. Flavin containing monooxygenase 4 Antibody, Novus Biologicals™

Flavin containing monooxygenase 4 Antibody, Novus Biologicals™

Artikelnummer. 18248662 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
100 μL
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18248662 100 μL 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18248662 Lieferant Novus Biologicals Lieferanten-Nr. NBP169026

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

Flavin containing monooxygenase 4 Polyclonal specifically detects Flavin containing monooxygenase 4 in Rat samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen Flavin containing monooxygenase 4
Anwendungen Western Blot
Klassifikation Polyclonal
Konzentration 0.5 mg/ml
Konjugat Unconjugated
Verdünnung Western Blot 1.0 ug/ml
Zusammensetzung PBS, 2% Sucrose with 0.09% Sodium Azide
Gen-Zugriffsnummer Q8K4B7
Gen-Alias dimethylaniline monooxygenase [N-oxide-forming] 4, Dimethylaniline oxidase 4, EC 1.14.13.8, flavin containing monooxygenase 4, FMO 4, FMO2, Hepatic flavin-containing monooxygenase 4
Gensymbole FMO4
Wirtsspezies Rabbit
Immunogen Synthetic peptides corresponding to Fmo4 (flavin containing monooxygenase 4) The peptide sequence was selected from the middle region of Fmo4. Peptide sequence PGIHKFKGQILHSQEYRIPDAFRGKRILVVGLGNTGGDVAVELSGIAAQV.
Molekulargewicht des Antigens 64 kDa
Reinigungsverfahren Affinity purified
Menge 100 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 2329
Testspezifität Zebrafish: 86%.
Rekonstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Zielspezies Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.