missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FANCD2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
418.00 CHF - 630.00 CHF
Spezifikation
| Antigen | FANCD2 |
|---|---|
| Anwendungen | Immunocytochemistry, Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18278894
|
Novus Biologicals
NBP2-57171 |
100 μL |
630.00 CHF
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18634087
|
Novus Biologicals
NBP2-57171-25ul |
25 μL |
418.00 CHF
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
FANCD2 Polyclonal specifically detects FANCD2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Spezifikation
| FANCD2 | |
| Polyclonal | |
| Rabbit | |
| Breast Cancer, Cancer, DNA Double Strand Break Repair, DNA Repair, Epigenetics, Genes Sensitive to DNA Damaging Agents | |
| DKFZp762A223, FA4, FACD, FAD, FAD2, FA-D2, FADFAD2, FANCD, Fanconi anemia complementation group D2, Fanconi anemia group D2 protein, Fanconi anemia, complementation group D2, FLJ23826, FPN1, HFE4, IREG1, Protein FACD2, SLC11A3 | |
| FANCD2 | |
| IgG | |
| Affinity Purified | |
| 164.1 kDa |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 2177 | |
| This FANCD2 Antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISELREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts