missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FANCD2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-57171-25ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
FANCD2 Polyclonal specifically detects FANCD2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spezifikation
| FANCD2 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| DKFZp762A223, FA4, FACD, FAD, FAD2, FA-D2, FADFAD2, FANCD, Fanconi anemia complementation group D2, Fanconi anemia group D2 protein, Fanconi anemia, complementation group D2, FLJ23826, FPN1, HFE4, IREG1, Protein FACD2, SLC11A3 | |
| Rabbit | |
| 164.1 kDa | |
| 25 μL | |
| Breast Cancer, Cancer, DNA Double Strand Break Repair, DNA Repair, Epigenetics, Genes Sensitive to DNA Damaging Agents | |
| 2177 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| FANCD2 | |
| This FANCD2 Antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISELREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFD | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur