missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. SLC38A3 Antibody - Azide and BSA Free, R&D Systems™

SLC38A3 Antibody - Azide and BSA Free, R&D Systems™

Code produit 18620691 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Menge:
0.02 mL
0.1 mL
Conditionnement:
0.02 Milliliter
0.10 Milliliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Menge Conditionnement
18620691 0.02 mL 0.02 Milliliter
18686580 0.1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18620691 Fournisseur Novus Biologicals Code fournisseur NBP2931430.02ml

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 Voir les produits de remplacement

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

SLC38A3 Polyclonal antibody specifically detects SLC38A3 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Spécification

Antigen SLC38A3
Anwendungen Western Blot
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 1:500-1:2000
Zusammensetzung PBS (pH 7.3), 50% glycerol
Gen-Alias G17sodium-coupled neutral amino acid transporter 3, Na(+)-coupled neutral amino acid transporter 3, NAT1, N-system amino acid transporter 1, SN1system N1 Na+ and H+-coupled glutamine transporter, SNAT3, Solute carrier family 38 member 3, solute carrier family 38, member 3, System N amino acid transporter 1
Wirtsspezies Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human SLC38A3 (NP_006832.1). MEAPLQTEMVELVPNGKHSEGLLPVITPMAGNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGK
Reinigungsverfahren Affinity purified
Menge 0.02 mL
Regulatorischer Status RUO
Forschungsgebiet Amino Acids Drugs and other small molecules, Endocrinology, Signal Transduction
Primär oder sekundär Primary
Gen-ID (Entrez) 10991
Zielspezies Human, Mouse, Rat
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotype IgG
Produktlinie Novus
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.