missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ELAVL4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP1-57402
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
ELAVL4 Polyclonal specifically detects ELAVL4 in Human samples. It is validated for Western Blot.
Spezifikation
| ELAVL4 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| abnormal vision, Drosophila, homolog of, like-4, ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D), HuD, Paraneoplastic encephalomyelitis antigen HuD | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Bovine: 92%; Chicken: 92%; Canine: 92%; Guinea pig: 92%; Equine: 92%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Zebrafish: 78%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| P26378 | |
| ELAVL4 | |
| Synthetic peptides corresponding to ELAVL4(ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)) The peptide sequence was selected from the N terminal of ELAVL4. Peptide sequence MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μL | |
| Neuroscience, Vision | |
| 1996 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur