DSS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marke: Novus Biologicals NBP2-57559-25ul

Lernen Sie weitere Varianten dieses

Artikelnummer. 18685868

469.00 CHF / 25 Mikroliter

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

DSS1 Polyclonal specifically detects DSS1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Spezifikation

Antigen	DSS1
Klassifikation	Polyclonal
Verdünnung	Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Gen-Alias	26S proteasome complex subunit DSS1, Deleted in split hand/split foot protein 1, deleted in split-hand/split-foot 1, DSS1Split hand/foot malformation type 1 protein, ECD, SEM1, Shfdg1, SHSF1SHFD1, Split hand/foot deleted protein 1, split hand/foot malformation (ectrodactyly) type 1
Wirtsspezies	Rabbit
Reinigungsverfahren	Affinity Purified
Regulatorischer Status	RUO
Gen-ID (Entrez)	7979
Zielspezies	Human
Form	Purified

Anwendungen	Immunocytochemistry, Immunofluorescence
Konjugat	Unconjugated
Zusammensetzung	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gensymbole	SHFM1
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDED
Menge	25 μL
Primär oder sekundär	Primary
Testspezifität	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Inhalt und Lagerung	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype	IgG

Produktvorschläge

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

For Research Use Only

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

DSS1 Antibody, Novus Biologicals™

Beschreibung

Spezifikation

Produktvorschläge

Dokumentation

Aktionen