missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ Cysteine/histidine-rich 1 Recombinant Protein Antigen

Artikelnummer. 18261085 Alle ansehen Bio Techne Produkte
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 18261085

Marke: Novus Biologicals™ NBP256486PEP

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human cysteine/histidine-rich 1. Source: E.coli Amino Acid Sequence: ECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGSELMEILDGMDQSHRKEMQLYNSIFSLLSFEKIGYTEVQFRPYRTDDFIT The cysteine/histidine-rich 1 Recombinant Protein Antigen is derived from E. coli. The cysteine/histidine-rich 1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Spezifikation

Gene ID (Entrez) 50626
Reinigungsverfahren >80% by SDS-PAGE and Coomassie blue staining
Gebräuchliche Bezeichnung Cysteine/histidine-rich 1 Recombinant Protein Antigen
Inhalt und Lagerung Store at −20°C. Avoid freeze-thaw cycles.
Zusammensetzung PBS and 1M Urea, pH 7.4.
Zur Verwendung mit (Anwendung) Blocking/Neutralizing, Control
Gen-Alias CHRP, cysteine and histidine rich 1, cysteine and histidine-rich protein 1, cysteine/histidine-rich 1, KIAA0496cysteine and histidine rich protein, MGC13010
Gensymbol CYHR1
Markertyp Unmarkiert
Produkttyp Recombinant Protein Antigen
Menge 100 μl
Kennzeichnung RUO
Quelle E. coli
Spezifische Reaktivität This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49974. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Mehr anzeigen Weniger anzeigen

Nur für Forschungszwecke.

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt