missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. Connexin 46/GJA3 Antibody, Novus Biologicals™

Connexin 46/GJA3 Antibody, Novus Biologicals™

Artikelnummer. 18264513 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
100 μL
25 μL
Packungsgröße:
100 Mikroliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18264513 100 μL 100 Mikroliter
18698877 25 μL 25 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18264513 Lieferant Novus Biologicals Lieferanten-Nr. NBP258660

om dit product te kopen Registreer vandaag om een webaccount aan te maken

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

Connexin 46/GJA3 Polyclonal specifically detects Connexin 46/GJA3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen Connexin 46/GJA3
Anwendungen Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunohistochemistry-Paraffin 1:50 - 1:200
Zusammensetzung PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gen-Alias CAE3, connexin 46, connexin-46, Cx46, CX46gap junction alpha-3 protein, CZP3, gap junction protein, alpha 3, 46kD (connexin 46), gap junction protein, alpha 3, 46kDa, gap junction protein, alpha 3, 46kDa (connexin 46)
Gensymbole GJA3
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEEKKKEREEEEQLKRESPSPKEPPQDNPSSRDDRGRVRMAG
Reinigungsverfahren Affinity Purified
Menge 100 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 2700
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.