missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Complement Factor H-related 1/CFHR1/CFHL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Bio-Techne NBP2-14475
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Complement Factor H-related 1/CFHR1/CFHL1 Polyclonal specifically detects Complement Factor H-related 1/CFHR1/CFHL1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Spezifikation
| Complement Factor H-related 1/CFHR1/CFHL1 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| CFHL1FHR-1, CFHLCFHR1P, complement factor H-related 1, complement factor H-related 1 pseudogene, complement factor H-related protein 1, FHR1CFHL1P, H factor (complement)-like 1, H factor (complement)-like 2, H factor-like protein 1, H36-1, H36-2, H-factor-like 1, HFL1H36, HFL2, MGC104329 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 3078 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CFHR1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: YKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWS | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Complement Factor H-related 1/CFHR1/CFHL1 Antibody, Novus Biologicals™ > 0.1mL; Unlabeled
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur