Learn More
Complement Factor H-related 1/CFHR1/CFHL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
407.00 CHF - 579.00 CHF
Spezifikation
Antigen | Complement Factor H-related 1/CFHR1/CFHL1 |
---|---|
Verdünnung | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Anwendungen | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Klassifikation | Polyclonal |
Konjugat | Unconjugated |
Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | ||||||
---|---|---|---|---|---|---|---|---|---|---|
Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | ||||||
18476331
|
Novus Biologicals
NBP2-14475-25ul |
25ul |
407.00 CHF
25 Mikroliter |
Verfügbar ab: 18-07-2025
Loggen Sie sich ein, um den Lagerbestand zu sehen |
Sie haben bereits ein Konto? Melden Sie sich an um den Preis und die Verfügbarkeit zu sehen. Neu hier? Registrieren Sie sich noch heute bei uns! |
|||||
18148251
|
Bio-Techne
NBP2-14475 |
0.1 mL |
579.00 CHF
0.10 Milliliter |
Verfügbar ab: 18-07-2025
Loggen Sie sich ein, um den Lagerbestand zu sehen |
Sie haben bereits ein Konto? Melden Sie sich an um den Preis und die Verfügbarkeit zu sehen. Neu hier? Registrieren Sie sich noch heute bei uns! |
|||||
Beschreibung
Complement Factor H-related 1/CFHR1/CFHL1 Polyclonal specifically detects Complement Factor H-related 1/CFHR1/CFHL1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Spezifikation
Complement Factor H-related 1/CFHR1/CFHL1 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
3078 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: YKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWS | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Polyclonal | |
Rabbit | |
Human | |
CFHL1FHR-1, CFHLCFHR1P, complement factor H-related 1, complement factor H-related 1 pseudogene, complement factor H-related protein 1, FHR1CFHL1P, H factor (complement)-like 1, H factor (complement)-like 2, H factor-like protein 1, H36-1, H36-2, H-factor-like 1, HFL1H36, HFL2, MGC104329 | |
CFHR1 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.