missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Complement Factor H-related 1/CFHR1/CFHL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
469.00 CHF - 703.00 CHF
Spezifikation
| Antigen | Complement Factor H-related 1/CFHR1/CFHL1 |
|---|---|
| Verdünnung | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Anwendungen | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18476331
|
Novus Biologicals
NBP2-14475-25ul |
25ul |
469.00 CHF
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18148251
|
Novus Biologicals
NBP2-14475 |
0.1 mL |
703.00 CHF
0.10 Milliliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
Complement Factor H-related 1/CFHR1/CFHL1 Polyclonal specifically detects Complement Factor H-related 1/CFHR1/CFHL1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Spezifikation
| Complement Factor H-related 1/CFHR1/CFHL1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 3078 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: YKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| CFHL1FHR-1, CFHLCFHR1P, complement factor H-related 1, complement factor H-related 1 pseudogene, complement factor H-related protein 1, FHR1CFHL1P, H factor (complement)-like 1, H factor (complement)-like 2, H factor-like protein 1, H36-1, H36-2, H-factor-like 1, HFL1H36, HFL2, MGC104329 | |
| CFHR1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts