missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cholecystokinin-B R/CCKBR Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
257.00 CHF - 543.00 CHF
Spezifikation
| Antigen | Cholecystokinin-B R/CCKBR |
|---|---|
| Verdünnung | Western Blot 1:500-1:2000 |
| Anwendungen | Western Blot |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18652661
|
Novus Biologicals
NBP2-92171-0.02ml |
0.02 mL |
257.00 CHF
0.02 Milliliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18659230
|
Novus Biologicals
NBP2-92171-0.1ml |
0.1 mL | |||||||
Beschreibung
Cholecystokinin-B R/CCKBR Polyclonal antibody specifically detects Cholecystokinin-B R/CCKBR in Human, Mouse, Rat samples. It is validated for Western BlotSpezifikation
| Cholecystokinin-B R/CCKBR | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication, GPCR, Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 887 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| CCK2 receptor, CCK2R, CCK2-R, CCK-B, CCK-B receptor, CCK-BR, CCKRB, cholecystokinin B receptor, Cholecystokinin-2 receptor, cholecystokinin-B receptor/gastrin receptor, GASR, gastrin receptor, gastrin/cholecystokinin type B receptor | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 240-335 of human CCKBR (NP_795344.1). LISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLLAKKRVVRML | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts