missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD300a/LMIR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP1-84431-25ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
CD300a/LMIR1 Polyclonal specifically detects CD300a/LMIR1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Spezifikation
| CD300a/LMIR1 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| CD300a antigenCMRF35H9, CD300a molecule, CLM-8, CMRF-35H, CMRF35-H, CMRF35H leukocyte immunoglobulin-like receptor, CMRF35-H9, CMRF-35-H9CD300 antigen-like family member A, CMRF35HIRp60, CMRF35-like molecule 8, IgSF12, IGSF12NK inhibitory receptor, Immunoglobulin superfamily member 12, Inhibitory receptor protein 60, IRC1, IRC1/IRC2, IRC2, Irp60, leukocyte membrane antigen | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CD300A | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK | |
| 25 μL | |
| Mast Cell Markers | |
| 11314 | |
| Human | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur