missing translation for 'onlineSavingsMsg'
Learn More
Learn More
B3GALNT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
568.00 CHF
Spezifikation
| Antigen | B3GALNT2 |
|---|---|
| Anwendungen | Western Blot |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18250864
|
Novus Biologicals
NBP1-57930 |
100 μL |
568.00 CHF
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
B3GALNT2 Polyclonal specifically detects B3GALNT2 in Human samples. It is validated for Western Blot.Spezifikation
| B3GALNT2 | |
| Polyclonal | |
| Rabbit | |
| Q8NCR0 | |
| 148789 | |
| Synthetic peptides corresponding to B3GALNT2(beta-1,3-N-acetylgalactosaminyltransferase 2) The peptide sequence was selected from the middle region of B3GALNT2. Peptide sequence PESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| B3GalNAc-T2, beta 1,3-N-acetylgalactosaminyltransferase-II (MGC39558), beta-1,3-galactosaminyltransferase 2, Beta-1,3-GalNAc-T2, beta-1,3-N-acetylgalactosaminyltransferase 2, Beta-1,3-N-acetylgalactosaminyltransferase II, EC 2.4.1, EC 2.4.1.-, MGC39558, UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2, UDP-GalNAc:betaGlcNAc beta 1,3-galactosaminyltransferase, polypeptide 2, UDP-GalNAc:betaGlcNAc beta-1,3-galactosaminyltransferase, polypeptide 2 | |
| B3GALNT2 | |
| IgG |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts