missing translation for 'onlineSavingsMsg'
Learn More
Learn More
B3GALNT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP1-57930
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Description
B3GALNT2 Polyclonal specifically detects B3GALNT2 in Human samples. It is validated for Western Blot.
Specifications
| B3GALNT2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| B3GalNAc-T2, beta 1,3-N-acetylgalactosaminyltransferase-II (MGC39558), beta-1,3-galactosaminyltransferase 2, Beta-1,3-GalNAc-T2, beta-1,3-N-acetylgalactosaminyltransferase 2, Beta-1,3-N-acetylgalactosaminyltransferase II, EC 2.4.1, EC 2.4.1.-, MGC39558, UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2, UDP-GalNAc:betaGlcNAc beta 1,3-galactosaminyltransferase, polypeptide 2, UDP-GalNAc:betaGlcNAc beta-1,3-galactosaminyltransferase, polypeptide 2 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 148789 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q8NCR0 | |
| B3GALNT2 | |
| Synthetic peptides corresponding to B3GALNT2(beta-1,3-N-acetylgalactosaminyltransferase 2) The peptide sequence was selected from the middle region of B3GALNT2. Peptide sequence PESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFL. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Rat: 100%; Bovine: 92%; Canine: 92%; Guinea pig: 92%; Equine: 92%; Rabbit: 92%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction