missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemische Reagenzien
  4. Peptide
  5. 18245214

Novus Biologicals™ Aspartate Aminotransferase Recombinant Protein Antigen

Product Code. 18245214 Shop All Bio Techne Products
Change view
Click to view available options
Menge:
100 μl
Unit Size:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Menge unitSize
18245214 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18245214 Supplier Novus Biologicals™ Supplier No. NBP257518PEP

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Aspartate Aminotransferase. Source: E.coli Amino Acid Sequence: IGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ The Aspartate Aminotransferase Recombinant Protein Antigen is derived from E. coli. The Aspartate Aminotransferase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Specifications

Gene ID (Entrez) 2805
Reinigungsverfahren >80% by SDS-PAGE and Coomassie blue staining
Gebräuchliche Bezeichnung Aspartate Aminotransferase Recombinant Protein Antigen
Inhalt und Lagerung Store at −20°C. Avoid freeze-thaw cycles.
Zusammensetzung PBS and 1M Urea, pH 7.4.
Zur Verwendung mit (Anwendung) Blocking/Neutralizing, Control
Gen-Alias aspartate aminotransferase, cytoplasmic, EC 2.6.1.1, GIG18, Glutamate oxaloacetate transaminase 1, glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1), growth-inhibiting protein 18, Transaminase A
Gensymbol GOT1
Markertyp Unmarkiert
Produkttyp Recombinant Protein Antigen
Menge 100 μl
Kennzeichnung RUO
Quelle E. coli
Spezifische Reaktivität This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50901. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Show More Show Less

Nur für Forschungszwecke.

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.