missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. ARMCX3 Antibody, Novus Biologicals™

ARMCX3 Antibody, Novus Biologicals™

Product Code. 18435771 Shop All Bio Techne Products
Change view
Click to view available options
Menge:
0.1 mL
25 μL
Unit Size:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Menge unitSize
18435771 25 μL 25 Mikroliter
18286538 0.1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18435771 Supplier Novus Biologicals Supplier No. NBP18914225ul

om dit product te kopen Registreer vandaag om een webaccount aan te maken

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 1 publication

ARMCX3 Polyclonal specifically detects ARMCX3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ARMCX3
Anwendungen Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunohistochemistry 1:10-1:20, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:20
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gen-Zugriffsnummer Q9UH62
Gen-Alias ALEX3arm protein lost in epithelial cancers, X chromosome, 3, ARM protein lost in epithelial cancers on chromosome X 3, armadillo repeat containing, X-linked 3, armadillo repeat-containing X-linked protein 3,1200004E24Rik, dJ545K15.2, DKFZp781N1954, KIAA0443, MGC12199, Protein ALEX3
Gensymbole ARMCX3
Wirtsspezies Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHM
Molekulargewicht des Antigens 43 kDa
Reinigungsverfahren Affinity Purified
Menge 25 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 51566
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.