missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aquaporin-5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-39043
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
Aquaporin-5 Polyclonal specifically detects Aquaporin-5 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Spécification
| Aquaporin-5 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| P55064 | |
| AQP5 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTT | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| AQP-5, aquaporin 5, aquaporin-5 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 362 | |
| Human | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu