missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. CD8 Antibody (CL1529), R&D Systems™

CD8 Antibody (CL1529), R&D Systems™

Artikelnummer. 18608625 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
25 μL
0.1 mL
Packungsgröße:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge Packungsgröße
18608625 25 μL 25 Mikroliter
18173519 0.1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18608625 Lieferant Novus Biologicals Lieferanten-Nr. NBP23674325ul
 Eingeschränkter Artikel
Verfügbar ab: 01-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

CD8 Monoclonal specifically detects CD8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen CD8
Anwendungen Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Monoclonal
Klon CL1529
Konjugat Unconjugated
Verdünnung Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gen-Zugriffsnummer P01732
Gen-Alias CD8, CD8a molecule, LEU2, p32
Gensymbole CD8A
Wirtsspezies Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT
Reinigungsverfahren Protein A purified
Menge 25 μL
Regulatorischer Status RUO
Forschungsgebiet Innate Immunity
Primär oder sekundär Primary
Gen-ID (Entrez) 925
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Rekonstitution Protein A purified
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Produkttyp Antibody
Form Purified
Isotype IgG1
Produktlinie Novus
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.