missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. AlphaB Crystallin/CRYAB Antibody, R&D Systems™

AlphaB Crystallin/CRYAB Antibody, R&D Systems™

Artikelnummer. 18603409 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Menge:
25 μL
0.1 mL
Packungsgröße:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge Packungsgröße
18603409 0.1 mL 0.10 Milliliter
18649696 25 μL 25 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18603409 Lieferant Novus Biologicals Lieferanten-Nr. NBP249246
 Eingeschränkter Artikel
Verfügbar ab: 01-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

AlphaB Crystallin/CRYAB Polyclonal antibody specifically detects AlphaB Crystallin/CRYAB in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen AlphaB Crystallin/CRYAB
Anwendungen Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Zusammensetzung PBS (pH 7.2), 40% Glycerol
Gen-Alias alpha B crystallin, alpha(B)-crystallin, alpha-crystallin B chain, CRYA2alpha crystallin B chain, crystallin, alpha B, CTPP2, Heat shock protein beta-5, heat-shock 20 kD like-protein, HSPB5, Renal carcinoma antigen NY-REN-27, Rosenthal fiber component
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAA
Reinigungsverfahren Immunogen affinity purified
Menge 0.1 mL
Regulatorischer Status RUO
Forschungsgebiet Cancer, Cell Biology, Cell Cycle and Replication, Golgi Apparatus Markers, Membrane Trafficking and Chaperones, Neuroscience, Neurotransmission, Protein Phosphatase, Sensory Systems, Signal Transduction, Tyrosine Kinases, Vision
Primär oder sekundär Primary
Gen-ID (Entrez) 1410
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotype IgG
Produktlinie Novus
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.