missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ AKT1/2/3 Inhibitor Peptide Set
Alle ansehen Bio Techne Produkte
Click to view available options
Menge:
2 mg
5 mg
Packungsgröße:
2 Milligramm
5 Milligramm
Spezifikation
Spezifikation
| Wirtsspezies | Human |
| Komponenten | Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361 |
| Zur Verwendung mit (Anwendung) | Inhibition of Akt kinase activity |
| Inhalt und Lagerung | Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. |
| Menge | 2 mg |
| Produkttyp | AKT1/2/3 Inhibitor Peptide Set |
| Molekulargewicht | 4214 |
| Hemmstoffe | AKT1/2/3 |
| Form | Lyophilisiert |
For Research Use Only
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur