missing translation for 'onlineSavingsMsg'
Learn More
Learn More
14-3-3 gamma Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
418.00 CHF - 595.00 CHF
Spezifikation
| Antigen | 14-3-3 gamma |
|---|---|
| Anwendungen | Western Blot, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18217850
|
Novus Biologicals
NBP2-54679 |
100 μL |
595.00 CHF
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18669167
|
Novus Biologicals
NBP2-54679-25ul |
25 μL |
418.00 CHF
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
14-3-3 gamma Polyclonal specifically detects 14-3-3 gamma in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Spezifikation
| 14-3-3 gamma | |
| Polyclonal | |
| Rabbit | |
| Cancer, Cell Cycle and Replication, Cellular Markers, Growth and Development, Neuronal Cell Markers, Neuroscience, Signal Transduction, Stem Cell Markers | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 7532 | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:EAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEIS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| 14-3-3 gamma, 14-3-3 protein gamma, 14-3-3GAMMA, KCIP-1, Protein kinase C inhibitor protein 1, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gammapolypeptide | |
| YWHAG | |
| IgG | |
| Immunogen affinity purified |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts