missing translation for 'onlineSavingsMsg'
Learn More
Learn More
14-3-3 gamma Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-54679-25ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
14-3-3 gamma Polyclonal specifically detects 14-3-3 gamma in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Spezifikation
| 14-3-3 gamma | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| 14-3-3 gamma, 14-3-3 protein gamma, 14-3-3GAMMA, KCIP-1, Protein kinase C inhibitor protein 1, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gammapolypeptide | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| YWHAG | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:EAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEIS | |
| 25 μL | |
| Cancer, Cell Cycle and Replication, Cellular Markers, Growth and Development, Neuronal Cell Markers, Neuroscience, Signal Transduction, Stem Cell Markers | |
| 7532 | |
| Human, Mouse, Rat | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur