Bio Techne

1 – 15 of 451,920 results

ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.

Target	Multi-Species
Specificity	The dsRNA Detection Kit allows sensitive and selective detection of dsRNA molecules (larger than 30-40 bp), independent of their nucleotide composition and sequence.
Product Type	ELISA Kit (Colorimetric)
Synonym	Double-stranded RNA
Assay Sensitivity	3 ng/ml
Storage Requirements	Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles.
Assay Range	1 - 300 ng/ml (0.1 - 30 ng/well)
For Use With (Application)	ELISA

Rabbit Polyclonal Antibody has been used in 4 publications

Antigen	Factor VIII
Gene Symbols	F8
Regulatory Status	RUO
Purification Method	Affinity Purified
Target Species	Mouse,Rat
Host Species	Rabbit
Applications	Western Blot,Immunofluorescence,Immunohistochemistry (Paraffin)
Immunogen	A synthetic peptide made to a C-terminal portion of human Factor VIII (between amino acids 2100-2250) [UniProt P00451]

Recombinant Protein

Purity or Quality Grade	>95% by SDS-PAGE and HPLC
Molecular Weight (g/mol)	26 kDa
Gene Symbol	HMGB1
Endotoxin Concentration	Less than 1 EU/ug of HMGB1/HMG-1 as determined by LAL method.
Storage Requirements	Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles.
Concentration	LYOPH
For Use With (Application)	PAGE
Protein	HMGB1/HMG-1
Accession Number	P09429, P09429, P09429
Gene Alias	Amphoterin, high mobility group box 1, High mobility group protein 1, high mobility group protein B1, high-mobility group (nonhistone chromosomal) protein 1, high-mobility group box 1, HMG-1, HMG1DKFZp686A04236, HMG3, SBP-1, Sulfoglucuronyl carbohydrate binding protein
Gene ID (Entrez)	3146
Formulation	Lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4.
Research Category	Cellular Markers, Chromatin Research, Neuroscience
Reconstitution	Recommended to centrifuge prior to opening. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0mg/mL. Apportion stock solutions into working aliquots and store at <-20°C.

Mouse Monoclonal Antibody has been used in 1 publication

Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Form	Purified
Isotype	IgG1
Concentration	1 mg/mL
Antigen	Npas4
Gene Symbols	NPAS4
Regulatory Status	RUO
Purification Method	Protein G purified
Dilution	Western Blot 1:1000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:100, Immunohistochemistry-Frozen
Gene Alias	BHLHE79, bHLHe79neuronal PAS domain-containing protein 4, Class E basic helix-loop-helix protein 79, Le-PAS, neuronal PAS domain protein 4, Neuronal PAS4, NXFHLH-PAS transcription factor NXF, PASD10PAS domain-containing protein 10
Gene ID (Entrez)	266743
Immunogen	Fusion protein amino acids 597-802 (C-terminus) of rat Npas4.
Classification	Monoclonal
Primary or Secondary	Primary
Test Specificity	Detects 90kDa.
Clone	S408-79

Mouse Monoclonal Antibody

Rabbit Polyclonal Antibody has been used in 16 publications

Rabbit Polyclonal Antibody

Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Form	Purified
Isotype	IgG
Research Discipline	Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction
Antigen	CPT2
Regulatory Status	RUO
Purification Method	Affinity purified
Dilution	Western Blot 1:100 - 1:500, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias	carnitine O-palmitoyltransferase 2, mitochondrial, carnitine palmitoyltransferase 2, Carnitine palmitoyltransferase IIEC 2.3.1.21, CPT II, CPT1, CPTASE
Gene ID (Entrez)	1376
Formulation	PBS (pH 7.3), 50% glycerol
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 420-658 of human CPT2 (NP_000089.1).,, Sequence:, VALDKQNKHTSYISGPWFDMYLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHLNPAKSDTITFKRLIRFVPSSLS
Classification	Polyclonal
Primary or Secondary	Primary

Rabbit Polyclonal Antibody

Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Form	Purified
Isotype	IgG
Research Discipline	metabolism
Antigen	ETHE1
Regulatory Status	RUO
Purification Method	Affinity purified
Dilution	Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias	D83198, EC 3.1.2.6, ethylmalonic encephalopathy 1, Ethylmalonic encephalopathy protein 1, Hepatoma subtracted clone one protein, HSCOEC 3.-, protein ETHE1, mitochondrial, YF13H12
Gene ID (Entrez)	23474
Formulation	PBS (pH 7.3), 50% glycerol
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 8-245 of human ETHE1 (NP_055112.2).,, Sequence:, VARRQLSQRGGSGAPILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANM
Classification	Polyclonal
Primary or Secondary	Primary

Rabbit Polyclonal Antibody

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry,Immunofluorescence,Immunofluorescence,Immunohistochemistry (Paraffin)
Isotype	IgG
Antigen	CARS2
Gene Symbols	CARS2
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gene Alias	CysRS, Cysteine TRNA Ligase 2, Cysteine TRNA Ligase 2, Mitochondrial (Putative), Cysteine--tRNA ligase, cysteinyl-tRNA synthetase, Cysteinyl-TRNA Synthetase 2, Mitochondrial (Putative), EC 6.1.1, EC 6.1.1.16, Mitochondrial (Putative), Probable Cysteine--TRNA Ligase, Mitochondrial, Probable Cysteinyl-TRNA Synthetase, Mitochondrial
Gene ID (Entrez)	79587
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: VFGAIISYFEQFFETVGISLANQQYVSGDGSEATLHGVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINIKDRSSTTSTWELLDQR
Classification	Polyclonal
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.