accessibility menu, dialog, popup

UserName

Gefilterte Suchergebnisse

Produkte von einigen unserer Lieferanten werden in den gefilterten Suchergebnissen nicht angezeigt. Bitte deaktivieren Sie alle Filter, um diese Produkte zu sehen.

Ergebnisse verfeinern

Ergebnisse verfeinern

kategorie

marken

  • (18)
  • (10)

Form

  • (11)
1 – 15 von 21 Ergebnisse
3

Novus Biologicals™ TLR4 Inhibitor Peptide Set

Applications: Flow Cytometry, Functional, In vitro assay, Binding Inhibition, Block/Neutralize

4

Novus Biologicals™ IKK gamma Inhibitor Peptide Set

Applications: In vitro assay, In vivo assay, Functional (Inhibition), Block/Neutralize

7

R&D Systems™ Caspase-9 Inhibitor Z-LEHD-FMK

Used as cell-permeable, irreversible inhibitor of caspase activity. R&D Systems Caspase-9 Inhibitor Z-LEHD-FMK binds to the active site of activated proteases irreversibly and inhibits apoptosis.

8

Novus Biologicals™ NFkB p50 (NLS) Inhibitor Peptide Set

Applications: Functional (Inhibition)

Inhalt und Lagerung Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
9

Novus Biologicals™ TRAF-6 Inhibitor Peptide Set

Applications: In vitro assay, Block/Neutralize

Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
10

Novus Biologicals™ AKT1/2/3 Inhibitor Peptide Set

For use in research applications

Inhalt und Lagerung Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Molekulargewicht 4214
Form Lyophilisiert
Komponenten Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
Hemmstoffe AKT1/2/3
Zur Verwendung mit (Anwendung) Inhibition of Akt kinase activity
Wirtsspezies Human
Produkttyp AKT1/2/3 Inhibitor Peptide Set
11
Sonderaktionen verfügbar

R&D Systems™ Recombinant Human Active PKA C alpha Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

12

R&D Systems™ Caspase-8 Inhibitor Z-IETD-FMK

Used as cell-permeable, irreversible inhibitor of caspase activity. R&D Systems Caspase-13 Inhibitor Z-LEED-FMK binds to the active site of activated proteases irreversibly and inhibits apoptosis.

13

Novus Biologicals™ ERK1 Inhibitor Peptide Set

For use in research applications

Inhalt und Lagerung Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Molekulargewicht 3795
Form Lyophilisiert
Komponenten ERK Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
Hemmstoffe ERK1
Zur Verwendung mit (Anwendung) Inhibition of Erk activation
Wirtsspezies Human, Mouse, Rat, Hamster, Rabbit, Xenopus
Produkttyp ERK1 Inhibitor Peptide Set
14
Sonderaktionen verfügbar

R&D Systems™ Recombinant Human Active p38 alpha Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

15
Sonderaktionen verfügbar

R&D Systems™ Caspase-1/ICE Inhibitor Z-WEHD-FMK

Used as cell-permeable, irreversible inhibitor of caspase activity. R&D Systems Caspase-1/ICE Inhibitor Z-WEHD-FMK binds to the active site of activated proteases irreversibly and inhibits apoptosis.