accessibility menu, dialog, popup

UserName

Gefilterte Suchergebnisse

Produkte von einigen unserer Lieferanten werden in den gefilterten Suchergebnissen nicht angezeigt. Bitte deaktivieren Sie alle Filter, um diese Produkte zu sehen.

Ergebnisse verfeinern

Ergebnisse verfeinern

kategorie

marken

  • (163)
  • (54)

spezialprogramme

  • (40)

Menge

  • (3)
  • (103)
  • (37)
  • (1)
  • (1)
  • (5)
  • (15)
  • (1)
  • (1)
  • (1)
  • (1)

Anwendungen

  • (3)
  • (10)
  • (18)
  • (42)
  • (3)
  • (1)
  • (12)
  • (1)
  • (10)
  • (28)
  • (84)
  • (1)
  • (4)
  • (2)
  • (45)

Konjugat

  • (2)
  • (9)
  • (11)
  • (5)
  • (10)
  • (3)
  • (10)
  • (6)
  • (11)
  • (3)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (1)
  • (2)
  • (4)
  • (1)
  • (5)
  • (4)
  • (4)
  • (1)
  • (4)
  • (49)
  • (4)
  • (3)
  • (4)

Regulatorischer Status

  • (164)

Zielspezies

  • (1)
  • (1)
  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (146)
  • (1)
  • (19)
  • (3)
  • (1)
  • (1)
  • (13)
  • (4)
  • (1)
  • (10)

Klassifikation

  • (138)
  • (25)

Form

  • (163)

Wirtsspezies

  • (1)
  • (77)
  • (79)
  • (6)

Isotype

  • (55)
  • (41)
  • (14)
  • (17)
  • (12)
  • (15)
  • (9)

Zur Verwendung mit (Anwendung)

  • (5)
  • (5)
  • (5)
  • (1)
  • (5)
1 – 15 von 208 Ergebnisse
2

Human Perforin Antibody, R&D Systems™
GREENER_CHOICE

Rabbit Monoclonal Antibody

Klon 2771C
Rekonstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Form Purified
Gen-Zugriffsnummer P14222
Konjugat Unconjugated
Isotype IgG
Primär oder sekundär Primary
Inhalt und Lagerung Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Zusammensetzung Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Klassifikation Monoclonal
Antigen Perforin
Regulatorischer Status RUO
Immunogen Chinese Hamster Ovary cell line CHO-derived human Perforin, Pro22-Trp555, Accession # P14222
Zielspezies Human
Wirtsspezies Rabbit
Reinigungsverfahren Protein A or G purified from cell culture supernatant
Anwendungen Immunohistochemistry
Verdünnung Immunohistochemistry 5-25 ug/mL
Gen-Alias Cytolysin, FLH2, HPLH2, HPLH2lymphocyte pore forming protein, Lymphocyte pore-forming protein, MGC65093, P1, P1PFN1, perforin 1 (pore forming protein), perforin-1, PFP, PFPcytolysin, PRF1
Gen-ID (Entrez) 5551
3

Human Aggrecan Antibody, R&D Systems™
GREENER_CHOICE

Mouse Monoclonal Antibody

Klon 179503
Rekonstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Form Purified
Gen-Zugriffsnummer NP_037359
Konjugat Unconjugated
Isotype IgG1
Primär oder sekundär Primary
Inhalt und Lagerung Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Zusammensetzung Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Klassifikation Monoclonal
Antigen Aggrecan
Regulatorischer Status RUO
Immunogen Mouse myeloma cell line NS0-derived recombinant human Aggrecan, Val20-Gly675, Accession # NP_037359
Zielspezies Human
Wirtsspezies Mouse
Reinigungsverfahren Protein A or G purified from hybridoma culture supernatant
Anwendungen ELISA
Verdünnung ELISA
Gen-Alias ACAN, AGC1, AGC1SEDK, aggrecan, aggrecan core protein, Cartilage-specific proteoglycan core protein, Chondroitin sulfate proteoglycan 1, Chondroitin sulfate proteoglycan core protein 1, CSPCP, CSPG1, CSPG1aggrecan 1, CSPGCP, large aggregating proteoglycan, MSK16, MSK16AGCAN, SEDK
Gen-ID (Entrez) 176
4

Human alpha 2-Macroglobulin Antibody, R&D Systems™
GREENER_CHOICE

Mouse Monoclonal Antibody

Klon 257303
Rekonstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Form Purified
Konjugat Unconjugated
Isotype IgG1
Primär oder sekundär Primary
Inhalt und Lagerung Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Zusammensetzung Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Klassifikation Monoclonal
Antigen alpha 2-Macroglobulin
Regulatorischer Status RUO
Immunogen Human plasma-derived alpha 2-Macroglobulin
Zielspezies Human
Wirtsspezies Mouse
Reinigungsverfahren Protein A or G purified from hybridoma culture supernatant
Anwendungen ELISA
Verdünnung ELISA
Gen-Alias A2M, alpha 2Macroglobulin, Alpha-2-M, alpha-2-macroglobulin, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5, CPAMD5, CPAMD5DKFZp779B086, FWP007, S863-7
Gen-ID (Entrez) 2
5

Mouse IL-36 alpha/IL-1F6 Antibody, R&D Systems™
GREENER_CHOICE

Rat Monoclonal Antibody

Klon 275302
Rekonstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Form Purified
Gen-Zugriffsnummer Q9JLA2
Konjugat Unconjugated
Isotype IgG2a
Primär oder sekundär Primary
Inhalt und Lagerung Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Zusammensetzung Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Klassifikation Monoclonal
Antigen IL-36 alpha/IL-1F6
Regulatorischer Status RUO
Immunogen E. coli-derived recombiMouset mouse IL-36 alpha/IL-1F6, Met1-His160, Accession # Q9JLA2
Zielspezies Mouse
Wirtsspezies Rat
Reinigungsverfahren Protein A or G purified from hybridoma culture supernatant
Anwendungen ELISA
Verdünnung ELISA
Gen-Alias FIL1, FIL1 epsilon, FIL1(EPSILON), FIL1E, IL-1 epsilon, IL1(EPSILON), IL1E, IL-1E, IL1F6, IL-1F6, IL-1F6 (FIL-1-epsilon), IL36 alpha, IL36A, interleukin 1 family, member 6 (epsilon), interleukin 1, epsilon, Interleukin 36, Alpha, Interleukin-1 epsilon, interleukin-1 family member 6, Interleukin-36 Alpha
Gen-ID (Entrez) 27179
6

Human Desmocollin-1 Antibody, R&D Systems™
GREENER_CHOICE

Rabbit Monoclonal Antibody

Klon 2906A
Rekonstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Form Purified
Gen-Zugriffsnummer Q08554
Konjugat Unconjugated
Isotype IgG
Primär oder sekundär Primary
Inhalt und Lagerung Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 6 months, -20 to -70 °C under sterile conditions after reconstitution.
Zusammensetzung Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied either lyophilized or as a 0.2 μm filtered solution in PBS.
Klassifikation Monoclonal
Antigen Desmocollin-1
Regulatorischer Status RUO
Immunogen Mouse myeloma cell line, NS0-derived human Desmocollin-1, Arg135-Asn686, Accession # Q08554
Zielspezies Human
Wirtsspezies Rabbit
Reinigungsverfahren Protein A or G purified from hybridoma culture supernatant
Anwendungen Immunohistochemistry
Verdünnung Immunohistochemistry 3-25 ug/mL
Gen-Alias cadherin family member 1, CDHF1, desmocollin 1, desmocollin-1, Desmocollin1, desmosomal glycoprotein 2/3, DG2/DG3, DSC1
Gen-ID (Entrez) 1823
7

Derlin 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Form Purified
Konjugat Unconjugated
Isotype IgG
Primär oder sekundär Primary
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Zusammensetzung PBS (pH 7.0)
Klassifikation Polyclonal
Antigen Derlin 1
Regulatorischer Status RUO
Immunogen Produced in rabbits immunized with E. coli-derived Human Derlin 1 fragment.
Zielspezies Human
Forschungsgebiet ER Markers, Immunology, Lipid and Metabolism, Protein Turnover, Signal Transduction, Unfolded Protein Response
Wirtsspezies Rabbit
Reinigungsverfahren Antigen and protein A Affinity-purified
Anwendungen Immunohistochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Verdünnung Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:100-1:500, Immunohistochemistry-Paraffin 1:50-1:200
Gen-Alias DER-1, DER1Degradation in endoplasmic reticulum protein 1, Der1-like domain family, member 1, Der1-like protein 1, derlin-1, DERtrin-1, FLJ13784, FLJ42092, MGC3067, PRO2577
Gen-ID (Entrez) 79139
8

OCTN1/SLC22A4 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Form Purified
Konjugat Unconjugated
Isotype IgG
Primär oder sekundär Primary
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Zusammensetzung PBS (pH 7.3), 50% glycerol
Klassifikation Polyclonal
Antigen OCTN1/SLC22A4
Regulatorischer Status RUO
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 42-141 of human SLC22A4 (NP_003050.2). LAGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK
Zielspezies Human,Mouse,Rat
Wirtsspezies Rabbit
Reinigungsverfahren Affinity purified
Anwendungen Western Blot
Verdünnung Western Blot 1:1000-1:2000
Gen-Alias Ergothioneine transporter, ET transporter, ETT, MGC34546, MGC40524, OCTN1integral membrane transport protein, Organic cation/carnitine transporter 1, solute carrier family 22 (organic cation/ergothioneine transporter), member 4, solute carrier family 22 member 4, UT2H
Gen-ID (Entrez) 6583
9

Human FGFR1 alpha (IIIc) Alexa Fluor™ 647-conjugated Antibody, R&D Systems™
GREENER_CHOICE

Mouse Monoclonal Antibody

12

Novus Biologicals™ alpha Satellite Repeat Primer

alpha SAT primer for PCR in chromatin precipitation

Inhalt und Lagerung Store at –20°C. Avoid Free/Thaw Cycles
Zur Verwendung mit (Anwendung) Chromatin-Immunpräzipitation
Produkttyp alpha Satellite Repeat Primer
13

Novus Biologicals™ Recombinant Human DNA Polymerase iota GST (N-Term) Protein

Recombinant Protein

Gensymbol POLI
Zusammensetzung 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Lagerungsbedingungen Store at -80°C. Avoid freeze-thaw cycles.
Forschungskategorie DNA Polymerases, DNA Repair
Molekulargewicht MolecularWeight-theroretical: 106.7 kDa
Zur Verwendung mit (Anwendung) Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Gen-Alias DNA polymerase iota, EC 2.7.7.7, Eta2, polymerase (DNA directed) iota, RAD30 homolog B, RAD30Bpolymerase (DNA-directed), iota, RAD3OB
Protein DNA Polymerase iota
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Gen-ID (Entrez) 11201
14

ErbB2/Her2 Antibody (rERBB2/9401), Novus Biologicals™

Mouse Monoclonal Antibody

Klon rERBB2/9401
Form Purified
Konjugat Unconjugated
Isotype IgG2b κ
Konzentration 0.2 mg/mL
Primär oder sekundär Primary
Inhalt und Lagerung Store at 4°C.
Zusammensetzung 10 mM PBS with 0.05% BSA
Klassifikation Monoclonal
Antigen ErbB2/Her2
Regulatorischer Status RUO
Immunogen Recombinant fragment (around aa1155-1255) of human ErbB2/Her2 protein (exact sequence is proprietary)
Zielspezies Human
Forschungsgebiet Breast Cancer, Cancer, Cellular Markers, Core ESC Like Genes, Oncogenes, Phospho Specific, Protein Kinase, Stem Cell Markers, Tumor Suppressors
Wirtsspezies Mouse
Reinigungsverfahren Protein A purified
Anwendungen Immunohistochemistry (Paraffin)
Verdünnung Immunohistochemistry-Paraffin : 1-2 μg/mL
Gen-Alias CD340, CD340 antigen, c-erb B2/neu protein, EC 2.7.10, EGFR2, HER-2, HER2EC 2.7.10.1, herstatin, Metastatic lymph node gene 19 protein, MLN 19, MLN19, NEUHER-2/neu, neuroblastoma/glioblastoma derived oncogene homolog, NGLTKR1, p185erbB2, Proto-oncogene c-ErbB-2, Proto-oncogene Neu, receptor tyrosine-protein kinase erbB-2, Tyrosine kinase-type cell surface receptor HER2, v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2(neuro/glioblastoma derived oncogene homolog), v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastomaderived oncogene homolog (avian)
Gen-ID (Entrez) 2064
15

MMP-14/MT1-MMP Antibody (S05-6H5), Novus Biologicals™

Rabbit Monoclonal Antibody

Klon S05-6H5
Form Purified
Konjugat Unconjugated
Isotype IgG
Konzentration 0.3 mg/mL
Primär oder sekundär Primary
Inhalt und Lagerung Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles.
Zusammensetzung 50mM Tris-Glycine(pH 7.4), 0.15M NaCl, 40% Glycerol, 0.05% BSA
Klassifikation Monoclonal
Antigen MMP-14/MT1-MMP
Regulatorischer Status RUO
Immunogen A synthetic peptide of human MMP-14/MT1-MMP (Uniprot # P50281)
Zielspezies Human,Mouse,Rat
Forschungsgebiet Cancer, Extracellular Matrix
Wirtsspezies Rabbit
Reinigungsverfahren Affinity purified
Anwendungen Western Blot,ELISA,Immunohistochemistry,Immunofluorescence,Immunoprecipitation
Verdünnung Western Blot, ELISA, Immunohistochemistry 1:50, Immunocytochemistry/ Immunofluorescence 1:10-1:2000, Immunoprecipitation, Immunohistochemistry-Paraffin, RNA Inhibition, Sandwich ELISA 1:100-1:2000
Gen-Alias EC 3.4.24, EC 3.4.24.80, matrix metallopeptidase 14 (membrane-inserted), matrix metalloproteinase 14 (membrane-inserted), matrix metalloproteinase-14, membrane type 1 metalloprotease, Membrane-type matrix metalloproteinase 1, Membrane-type-1 matrix metalloproteinase, MMP-14, MMP-X1, MT1MMP, MT1-MMPMTMMP1, MT-MMP 1
Gen-ID (Entrez) 4323