accessibility menu, dialog, popup

UserName

Primärantikörper

Primäre Antikörper sind Immunglobuline, die ein bestimmtes relevantes Antigen mit hoher Affinität und Spezifität erkennen und binden, um dieses Antigen zu reinigen, zu erkennen und zu messen. Dazu gehören Antikörperpaare für spezifische biochemische Anwendungen.
Alle Primärantikörper (390)

Gefilterte Suchergebnisse

Produkte von einigen unserer Lieferanten werden in den gefilterten Suchergebnissen nicht angezeigt. Bitte deaktivieren Sie alle Filter, um diese Produkte zu sehen.

Ergebnisse verfeinern

Ausgewählte Filter

Alle entfernen

Keyword Search

nucleic acid purification

Ergebnisse verfeinern

Ergebnisse verfeinern

In dieser Kategorie wurden keine Ergebnisse gefunden. Entfernen Sie einige der ausgewählten Filter und versuchen Sie es erneut.

kategorie

marken

  • (2)
  • (5)
  • (362)
  • (8)
  • (13)

spezialprogramme

  • (14)

Anwendungen

  • (3)
  • (159)
  • (188)
  • (165)
  • (7)
  • (204)
  • (117)
Alle anzeigen

Klassifikation

  • (314)
  • (76)

Konjugat

  • (6)
  • (2)
  • (15)
  • (12)
  • (13)
  • (14)
  • (14)
Alle anzeigen

Wirtsspezies

  • (6)
  • (269)
  • (113)
  • (2)

Menge

  • (2)
  • (7)
  • (2)
  • (263)
  • (18)
  • (1)
  • (1)
Alle anzeigen

Zielspezies

  • (95)
  • (5)
  • (5)
  • (5)
  • (377)
  • (120)
  • (24)
Alle anzeigen

Isotype

  • (123)
  • (31)
  • (133)
  • (8)
  • (30)
  • (28)
  • (33)
Alle anzeigen

Regulatorischer Status

  • (335)

Form

  • (5)
  • (1)
  • (286)
  • (1)
1 – 15 von 361 Ergebnisse
1

MNAB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Form Purified
Konjugat Unconjugated
Isotype IgG
Primär oder sekundär Primary
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Zusammensetzung PBS (pH 7.2) and 40% Glycerol
Klassifikation Polyclonal
Antigen MNAB
Regulatorischer Status RUO
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: QKEPPKQKKQSLGEDHVILEEQKTILPVTSCFSQPLPVSISNASCLPITTSVSAGNLILKTHVMSEDKNDFLKPVANGKMV
Zielspezies Human
Forschungsgebiet Zinc Finger
Wirtsspezies Rabbit
Reinigungsverfahren Protein A purified
Anwendungen Immunofluorescence
Verdünnung Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Gen-Alias FLJ20301, FLJ20713, membrane associated DNA binding protein, membrane-associated nucleic acid binding protein, Membrane-associated nucleic acid-binding protein, MGC52176, MNAB, ring finger and CCCH-type domains 2, RING finger and CCCH-type zinc finger domain-containing protein 2, ring finger and CCCH-type zinc finger domains 2, RNF164RING finger protein 164
Gen-ID (Entrez) 54542
3

Invitrogen™ DJ-1 Monoclonal Antibody (4H4)
GREENER_CHOICE

Mouse Monoclonal Antibody

15

Invitrogen™ DJ-1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

Form Liquid
Gen-Zugriffsnummer O88767, Q99497, Q99LX0
Konjugat Unconjugated
Gensymbole Park7
Isotype IgG
Konzentration Conc. Not Determined
Primär oder sekundär Primary
Zusammensetzung whole serum with 5mM sodium azide
Klassifikation Polyclonal
Inhalt und Lagerung Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Antigen DJ-1
Gen Park7
Regulatorischer Status RUO
Immunogen Full length recombinant human DJ1 expressed in and purified from E. coli.
Zielspezies Human,Mouse,Rat
Wirtsspezies Rabbit
Anwendungen Immunohistochemistry,Western Blot,Immunocytochemistry
Produkttyp Antibody
Gen-Alias CAP1; Contraception-associated protein 1; CTA-215D11.1; dj1; DJ-1; DJ-1 protein; early onset 7; epididymis secretory sperm binding protein Li 67p; fertility protein SP22; FLJ27376; FLJ34360; FLJ92274; HEL-S-67p; hypothetical protein LOC449674; maillard deglycase; Oncogene DJ1; OTTHUMP00000001350; OTTHUMP00000001351; PARK7; PARK7 GENE; PARK7/DJ1; parkinson disease (autosomal recessive, early onset) 7; Parkinson disease 7; Parkinson disease protein 7; Parkinson disease protein 7 homolog; Parkinson disease protein 7 homolog; protein/nucleic acid deglycase DJ-1; parkinson protein 7; Parkinsonism associated deglycase; parkinsonism-associated deglycase; Protein CAP1; protein deglycase DJ-1; protein deglycase DJ-1zDJ-1; Protein DJ-1; protein DJ-1-like protein; protein DJ-1zDJ-1; Protein/nucleic acid deglycase DJ-1; RNA-binding protein regulatory subunit; SP22; zDJ-1; zgc:103725
Gen-ID (Entrez) 11315, 117287, 57320