missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MNAB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
317.00 CHF - 703.00 CHF
Spezifikation
| Antigen | MNAB |
|---|---|
| Verdünnung | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Anwendungen | Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18698878
|
Novus Biologicals
NBP2-68785-25ul |
25 μL |
317.00 CHF
25 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18631648
|
Novus Biologicals
NBP2-68785 |
100 μg |
703.00 CHF
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
MNAB Polyclonal antibody specifically detects MNAB in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpezifikation
| MNAB | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Zinc Finger | |
| PBS (pH 7.2) and 40% Glycerol | |
| 54542 | |
| IgG | |
| Protein A purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| FLJ20301, FLJ20713, membrane associated DNA binding protein, membrane-associated nucleic acid binding protein, Membrane-associated nucleic acid-binding protein, MGC52176, MNAB, ring finger and CCCH-type domains 2, RING finger and CCCH-type zinc finger domain-containing protein 2, ring finger and CCCH-type zinc finger domains 2, RNF164RING finger protein 164 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QKEPPKQKKQSLGEDHVILEEQKTILPVTSCFSQPLPVSISNASCLPITTSVSAGNLILKTHVMSEDKNDFLKPVANGKMV | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts