missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF597 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
568.00 CHF
Spezifikation
| Antigen | ZNF597 |
|---|---|
| Anwendungen | Western Blot |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18234656
|
Novus Biologicals
NBP1-80158 |
100 μL |
568.00 CHF
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
ZNF597 Polyclonal specifically detects ZNF597 in Human samples. It is validated for Western Blot.Spezifikation
| ZNF597 | |
| Polyclonal | |
| Rabbit | |
| NP_689670 | |
| 146434 | |
| Synthetic peptide directed towards the middle region of human ZNF597. Peptide sequence: GLAQHQKSHSAENTYESTNCDKHFNEKPNLALPEETFVSGPQYQHTKCMK | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ33071, zinc finger protein 597 | |
| ZNF597 | |
| IgG | |
| 48 kDa |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts