missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZER1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
597.00 CHF
Spezifikation
| Antigen | ZER1 |
|---|---|
| Anwendungen | Western Blot |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18263384
|
Novus Biologicals
NBP1-69105 |
100 μL |
597.00 CHF
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
ZER1 Polyclonal specifically detects ZER1 in Human samples. It is validated for Western Blot.Spezifikation
| ZER1 | |
| Polyclonal | |
| Rabbit | |
| C9orf60, chromosome 9 open reading frame 60, homolog of Zyg-11, Hzygzyg-11 homolog B (C. elegans)-like, protein zer-1 homolog, zer-1 homolog (C. elegans), ZYG homolog, Zyg-11 homolog B-like protein, ZYG11BL, ZYGRP11-545E17.4 | |
| ZER1 | |
| IgG | |
| 88 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 10444 | |
| Synthetic peptides corresponding to ZER1 (zer-1 homolog (C. elegans)) The peptide sequence was selected from the middle region of ZER1. Peptide sequence LTNSEYRSEQSVKLRRQVIQVVLNGMESYQEVTVQRNCCLTLCNFSIPEE. | |
| Primary |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts