missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ UBE2T Recombinant Protein
361.00 CHF - 547.00 CHF
Spezifikation
| Zugriffsnummer | AAH04152 |
|---|---|
| Zur Verwendung mit (Anwendung) | Antibody Production, Protein Array, ELISA, Western Blot |
| Zusammensetzung | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Gen-ID (Entrez) | 29089 |
| Molekulargewicht | 47.8 |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
16118992
|
Abnova™
H00029089-P01.10UG |
10 ug |
361.00 CHF
10 Mikrogramm |
Verfügbar ab: 03-06-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
|
16128992
|
Abnova™
H00029089-P01.25UG |
25 ug |
547.00 CHF
25 Mikrogramm |
Verfügbar ab: 03-06-2024
Loggen Sie sich ein, um den Lagerbestand zu sehen |
|||||
Beschreibung
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Spezifikation
| AAH04152 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 47.8 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| UBE2T | |
| Human | |
| Recombinant | |
| Solution |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 29089 | |
| UBE2T (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV | |
| HSPC150/PIG50 | |
| UBE2T | |
| Wheat Germ (in vitro) | |
| GST |