Learn More
Abnova™ TUBB3 Recombinant Protein
Beschreibung
- Encoded by tubulin, beta 3
- Molecular weight: 75.24kDa
- Preparation method: in vitro wheat germ expression system
- Purification: glutathione sepharose 4 fast flow
- Storage buffer:50 mM Tris-HCI, 10 mM reduced glutathione
- pH=8.0 in elution buffer
Sequence: MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNGASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSI
HQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK
Best when used within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Spezifikation
Spezifikation
| Zugriffsnummer | AAH00748 |
| Zur Verwendung mit (Anwendung) | Antibody Production, Protein Array, ELISA, Western Blot |
| Zusammensetzung | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Gen-ID (Entrez) | 10381 |
| Molekulargewicht | 75.24 |
| Name | TUBB3 (Human) Recombinant Protein (P01) |
| pH-Bereich | 8 |
| Vorbereitungsmethode | In vitro wheat germ expression system |
| Reinigungsverfahren | Glutathione Sepharose 4 Fast Flow |
| Qualitätskontrollen | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Mehr anzeigen |
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.