missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18607565

DOG1/TMEM16A Antibody (DG1/447 + DOG-1.1) - IHC-Prediluted, R&D Systems™

Codice prodotto. 18607565 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
7 mL
Dimensione della confezione:
7mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità Dimensione della confezione
18607565 7 mL 7mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18607565 Fornitore Novus Biologicals N. del fornitore NBP244381
 Articolo soggetto a restrizioni
Verfügbar ab: 26-11-2026
Aggiungi al carrello
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

DOG1/TMEM16A Monoclonal antibody specifically detects DOG1/TMEM16A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifica

Antigene DOG1/TMEM16A
Applicazioni Immunohistochemistry, Immunohistochemistry (Paraffin)
Classificazione Monoclonal
Clone DG1/447 + DOG-1.1
Coniugato Unconjugated
Diluizione Immunohistochemistry, Immunohistochemistry-Paraffin 0.25 - 0.5 μg/mL
Formulazione 10 mM PBS with 0.05% BSA
Alias gene ANO1, anoctamin 1, DOG1, ORAOV2, TAOS2, TMEM16A
Specie ospite Mouse
Immunogeno Recombinant human canine-1 protein (DG1/447) + A synthetic peptide from human canine-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1). (Uniprot: Q5XX6)
Metodo di purificazione Protein A or G purified
Quantità 7 mL
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 55107
Target Species Human
Content And Storage Store at 4°C.
Product Type Antibody
Forma Purified
Isotype IgG1 κ
Linea di prodotti Novus
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.