missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRAP220/MED1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-57045
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
TRAP220/MED1 Polyclonal specifically detects TRAP220/MED1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spezifikation
| TRAP220/MED1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| Activator-recruited cofactor 205 kDa component, ARC205, CRSP1TRIP2, CRSP200p53 regulatory protein RB18A, DRIP230PPAR-binding protein, mediator complex subunit 1DRIP205, mediator of RNA polymerase II transcription subunit 1, PBPPPARGBP, Peroxisome proliferator-activated receptor-binding protein, PPAR binding protein, PPARBPMGC71488, PPARG binding protein, RB18ATR-interacting protein 2, Thyroid hormone receptor-associated protein complex 220 kDa component, thyroid hormone receptor-associated protein complex component TRAP220, thyroid receptor interacting protein 2, Thyroid receptor-interacting protein 2, Trap220, TRAP220TRIP-2, vitamin D receptor-interacting protein 230 kD, Vitamin D receptor-interacting protein complex component DRIP205 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| MED1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCP | |
| 100 μL | |
| Cancer | |
| 5469 | |
| Human | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur