missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ TNNC2 Recombinant Protein
Human TNNC2 full-length ORF (AAH05323, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal
Marke: Abnova™ H00007125-P01.25ug
Additional Details : Gewicht : 0.00010kg
Beschreibung
Troponin (Tn), a key protein complex in the regulation of striated muscle contraction, is composed of 3 subunits. The Tn-I subunit inhibits actomyosin ATPase, the Tn-T subunit binds tropomyosin and Tn-C, while the Tn-C subunit binds calcium and overcomes the inhibitory action of the troponin complex on actin filaments. The protein encoded by this gene is the Tn-C subunit.
- Troponin C type 2 (fast)
- Molecular weight: 43.34kDa
- Preparation method: in vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 Fast Flow
- Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH 8 in the elution buffer
- Quality Control Testing: 12.5% SDS-PAGE stained with Coomassie Blue
Sequence:
MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ
Best use within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Spezifikation
| AAH05323 | |
| Solution | |
| 7125 | |
| TNNC2 (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| TNNC2 | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 43.34 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ | |
| TNNC2 | |
| Human | |
| Yes |