missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TEX19 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
568.00 CHF
Spezifikation
| Antigen | TEX19 |
|---|---|
| Anwendungen | Western Blot |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Wirtsspezies | Rabbit |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18244972
|
Novus Biologicals
NBP1-56811 |
100 μL |
568.00 CHF
100 Mikroliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
TEX19 Polyclonal specifically detects TEX19 in Human samples. It is validated for Western Blot.Spezifikation
| TEX19 | |
| Polyclonal | |
| Rabbit | |
| Q8NA77 | |
| 400629 | |
| Synthetic peptides corresponding to FLJ35767(FLJ35767 protein) The peptide sequence was selected from the middle region of FLJ35767. Peptide sequence PEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDADWTQGLPWRFEELLTCS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ35767, testis expressed 19, testis-expressed sequence 19 protein | |
| TEX19 | |
| IgG |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts