missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLC35A5 Antibody, R&D Systems™

SLC35A5 Antibody, R&D Systems™

Codice prodotto. 18614317 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantità:
25 μL
100 μL
Dimensione della confezione:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità Dimensione della confezione
18614317 25 μL 25µL
18226684 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18614317 Fornitore Novus Biologicals N. del fornitore NBP25824025ul
  • ONLINE EXCLUSIVE PRICE
    517.15 CHF
    443.10 CHF / 25 Mikroliter
    Sparen 74.05 CHF
    14% Rabatt
 Articolo soggetto a restrizioni
Verfügbar ab: 01-12-2026
Aggiungi al carrello
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

SLC35A5 Polyclonal specifically detects SLC35A5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Especificaciones

Antigene SLC35A5
Applicazioni Immunocytochemistry, Immunofluorescence
Classificazione Polyclonal
Coniugato Unconjugated
Diluizione Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulazione PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Alias gene DKFZp434E102, FLJ11130, FLJ20730, FLJ25973, probable UDP-sugar transporter protein SLC35A5, Solute carrier family 35 member A5, solute carrier family 35, member A5
Simboli geni SLC35A5
Specie ospite Rabbit
Immunogeno This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KPQVPEYAPRQERIRDLSGNLWERSSGDGEELERLTKPKSDESDEDTF
Metodo di purificazione Affinity Purified
Quantità 25 μL
Status giuridico RUO
Primario o secondario Primary
ID gene (immissione) 55032
Test di specificità Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Product Type Antibody
Isotype IgG
Linea di prodotti Novus
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.