missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Src Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-38165-25ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
Src Polyclonal specifically detects Src in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Spezifikation
| Src | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL | |
| P12931 | |
| SRC | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPAS | |
| 25 μL | |
| Cancer Stem Cells, Protein Kinase, Signal Transduction, Transcription Factors and Regulators, Tyrosine Kinases | |
| 6714 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| c-src, EC 2.7.10, EC 2.7.10.2, pp60c-src, Rous sarcoma, tyrosine kinase pp60c-src, tyrosine-protein kinase SRC-1, v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog, v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur