missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ SPRR3 Recombinant Protein Artikelnummer.: 16150962
Nur noch undefined auf Lager
Zum Warenkorb hinzufügen
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. Abnova™ SPRR3 Recombinant Protein

Abnova™ SPRR3 Recombinant Protein

Artikelnummer. 16150962
10 μg, 10 Mikrogramm
Click to view available options
Menge:
10 μg
25 μg
Packungsgröße:
10 Mikrogramm
25 Mikrogramm
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 16150962

Marke: Abnova™ H00006707P01.10ug

Nur noch undefined auf Lager
336.48 CHF gültig bis 2025-12-31
Benutzen Sie den Promotions-Code "25339" um Ihren Promotions-Preis zu erhalten.
Zum Warenkorb hinzufügen
Nur noch undefined auf Lager
Zum Warenkorb hinzufügen
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Zugriffsnummer AAH17802
Zur Verwendung mit (Anwendung) Antibody Production, Protein Array, ELISA, Western Blot
Zusammensetzung 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gen-ID (Entrez) 6707
Molekulargewicht 43.45
Name SPRR3 (Human) Recombinant Protein (P01)
pH-Bereich 8
Vorbereitungsmethode In vitro wheat germ expression system
Reinigungsverfahren Glutathione Sepharose 4 Fast Flow
Qualitätskontrollen 12.5% SDS-PAGE Stained with Coomassie Blue.
Menge 10 μg
Quelle Wheat Germ (in vitro)
Immunogen MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKVPEPCPSTVTPGPAQQKTKQK
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gebräuchliche Bezeichnung SPRR3
Gensymbol SPRR3
Kreuzreaktivität Human
Spezies Wheat Germ (in vitro)
Rekombinant Recombinant
Proteinmarkierung GST
Form Solution
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ SPRR3 Recombinant Protein >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.