Abnova™ SPDEF Recombinant Protein

Name: Abnova&trade; SPDEF Recombinant Protein
Brand: Abnova&trade;
SKU: 16127762
Price: 361.00 EUR

Marca: Abnova™ H00025803-P01.10ug

Detalles adicionales : Gewicht : 0.00010kg

Código de producto. 16127762

Cantidad

Verfügbar ab: 07-06-2024
Sie sich ein, um den Lagerbestand zu sehen

Añadir a la cesta

Descripción

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Zugriffsnummer	AAH21299
Zusammensetzung	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molekulargewicht	62.59
pH-Bereich	8
Reinigungsverfahren	Glutathione Sepharose 4 Fast Flow
Menge	10 ug
Immunogen	MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI
Gen-Alias	PDEF/RP11-375E1__A.3/bA375E1.3
Gensymbol	SPDEF
Spezies	Wheat Germ (in vitro)
Proteinmarkierung	GST

Zur Verwendung mit (Anwendung)	Antibody Production, Protein Array, ELISA, Western Blot
Gen-ID (Entrez)	25803
Name	SPDEF (Human) Recombinant Protein (P01)
Vorbereitungsmethode	In vitro wheat germ expression system
Qualitätskontrollen	12.5% SDS-PAGE Stained with Coomassie Blue.
Quelle	Wheat Germ (in vitro)
Lagerungsbedingungen	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gebräuchliche Bezeichnung	SPDEF
Kreuzreaktivität	Human
Rekombinant	Recombinant
Form	Solution

Sugerencias de productos

Descripción