missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLC6A19 Antibody, R&D Systems™

SLC6A19 Antibody, R&D Systems™

Codice prodotto. 18613116 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantity:
25 μL
0.1 mL
Dimensione della confezione:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantity Dimensione della confezione
18613116 25 μL 25µL
18674815 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18613116 Fornitore Novus Biologicals N. del fornitore NBP24878425ul
 Restricted Item
Verfügbar ab: 02-12-2026
Aggiungi al carrello
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

SLC6A19 Polyclonal specifically detects SLC6A19 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin).
TRUSTED_SUSTAINABILITY

Specifica

Antigen SLC6A19
Applications Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias B0AT1, FLJ20680, FLJ34635, HND, sodium-dependent amino acid transporter system B0, sodium-dependent neutral amino acid transporter B(0)AT1, solute carrier family 6 (neurotransmitter transporter), member 19, solute carrier family 6 (neutral amino acid transporter), member 19, Solute carrier family 6 member 19, System B(0) neutral amino acid transporter AT1, system B0 neutral amino acid transporter
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: MVRLVLPNPGLDARIPSLAELETIEQEEASSRPKWDNK
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 340024
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.