missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ Human GATA4 Partial ORF (NP_002043.2, 343 a.a. - 442 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human GATA4 Partial ORF (NP_002043.2, 343 a.a. - 442 a.a.) Recombinant Protein with GST-tag at N-terminal

Codice prodotto. 16108554
Cambia vista
Click to view available options
Quantità:
10 ug
25 ug
Dimensione della confezione:
10µg
25µg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantità Dimensione della confezione
16108554 10 ug 10µg
16118554 25 ug 25µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 16108554 Fornitore Abnova™ N. del fornitore H00002626Q01.10ug
  • ONLINE EXCLUSIVE PRICE
    383.00 CHF
    377.24 CHF / 10 Mikrogramm
    Sparen 5.76 CHF
    1% Rabatt
 Articolo soggetto a restrizioni
Aggiungi al carrello
Aggiungi al carrello

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Used for AP, Array, ELISA, WB-Re

This gene encodes a member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. This protein is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function. Mutations in this gene have been associated with cardiac septal defects. [provided by RefSeq]

Sequence: ASGASSNSSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA

Specifica

Numero di accesso NP_002043.2
Da utilizzare con (applicazione) Antibody Production, ELISA, Protein Array, Western Blot
Formulazione 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
ID gene (immissione) 2626
Peso molecolare 36.74kDa
Nome GATA4 (Human) Recombinant Protein (Q01)
Analisi di controllo qualità 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantità 10 ug
Immunogeno ASGASSNSSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA
Requisiti di stoccaggio Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Status giuridico RUO
Alias gene MGC126629
Nome comune GATA4
Simbolo del gene GATA4
Specie Wheat Germ (in vitro)
Recombinant Recombinant
Tag proteine GST
Sistema di espressione wheat germ expression system
Forma Liquid
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.