missing translation for 'onlineSavingsMsg'
Learn More

S100A11 Recombinant Protein, Abnova

Marke:  Abnova H00006282-P01.25ug

Additional Details : Gewicht : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16150482

  • 458.00 CHF / 25 Mikrogramm


Verfügbar ab
16-01-2020
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spezifikation

Spezifikation

AAH14354
Solution
6282
S100A11 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
S100A11
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
37.29
8
Glutathione Sepharose 4 Fast Flow
25 ug
MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
MLN70|S100C
S100A11
Wheat Germ (in vitro)
GST
Videos
Dokumentation