missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Renin R Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
221.00 CHF - 551.00 CHF
Spezifikation
| Antigen | Renin R |
|---|---|
| Verdünnung | Western Blot 1:500-1:2000 |
| Anwendungen | Western Blot |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
18639141
|
Novus Biologicals
NBP2-94053-0.02ml |
0.02 mL |
221.00 CHF
0.02 Milliliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
|
18644352
|
Novus Biologicals
NBP2-94053-0.1ml |
0.1 mL |
551.00 CHF
0.10 Milliliter |
Log in om dit product te kopen Registreer vandaag om een webaccount aan te maken | |||||
Beschreibung
Renin R Polyclonal antibody specifically detects Renin R in Human, Mouse, Rat samples. It is validated for Western BlotSpezifikation
| Renin R | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 10159 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| APT6M8-9, ATP6M8-9MRXE, ATPase H(+)-transporting lysosomal accessory protein 2, ATPase H(+)-transporting lysosomal-interacting protein 2, ATPase, H+ transporting, lysosomal accessory protein 2, ATPase, H+ transporting, lysosomal interacting protein 2, CAPER, ELDF10, Embryonic liver differentiation factor 10, ER-localized type I transmembrane adaptor, H+ transporting, lysosomal (vacuolar proton pump) membrane sectorassociated protein M8-9, M8-9, MGC99577, MSTP009, N14F, renin receptor, vacuolar proton ATP synthase membrane sector associated protein M8-9, V-ATPase M8.9 subunit, XMRE | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 251-350 of human ATP6AP2 (NP_005756.2). MYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts