missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. PPIL2 Antibody, R&D Systems™

PPIL2 Antibody, R&D Systems™

Code produit 18222012 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
100 μL
Conditionnement:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité Conditionnement
18222012 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18222012 Fournisseur Novus Biologicals Code fournisseur NBP154366
 Article restreint
Verfügbar ab: 02-12-2026
Ajouter au panier
Ajouter au panier

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

PPIL2 Polyclonal specifically detects PPIL2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.
TRUSTED_SUSTAINABILITY

Spécification

Antigène PPIL2
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugué Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Formule PBS, 2% Sucrose with 0.09% Sodium Azide
Numéro d’ordre du gène Q13356
Alias de gène CYC4, cyclophilin, 60kDa, cyclophilin-60, Cyclophilin-like protein Cyp-60, Cyp-60, CYP60, EC 5.2.1.8, FLJ39930, hCyP-60, MGC33174, MGC787, peptidylprolyl cis-trans isomerase, peptidyl-prolyl cis-trans isomerase-like 2, peptidylprolyl isomerase (cyclophilin)-like 2, PPIase, Rotamase PPIL2
Symboles de gène(s) PPIL2
Espèces hôtes Rabbit
Immunogène Synthetic peptides corresponding to PPIL2(peptidylprolyl isomerase (cyclophilin)-like 2) The peptide sequence was selected from the C terminal of PPIL2. Peptide sequence GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ.
Poids moléculaire de l’antigène 59 kDa
Méthode de purification Affinity purified
Quantité 100 μL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 23759
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Espèces cibles Human
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.