missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant West Nile Virus WNV Pre-M Protein

A cDNA sequence encoding the WNV Pre-M was constructed and used to recombinantly synthesize the protein.

Marke:  enQuireBio™ QP13965-1mg

Additional Details : Gewicht : 0.01000kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 15965259

Menge Preis
1 1698.86 CHF / 1 Milligramm
3 1564.99 CHF / 1 Milligramm
Voraussichtliches Versanddatum: 02-11-2021

Zum Warenkorb hinzufügen


Beschreibung

Beschreibung

Spezifikation

Spezifikation

West Nile Virus WNV Pre-M Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
West Nile Virus
His
20mM phosphate buffer pH 7.5.
Protein is >95% pure as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate