missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rat RAP Protein

A cDNA sequence encoding the RAP was constructed and used to recombinantly synthesize the protein.

Marke:  enQuireBio™ QP13264-5ug

Additional Details : Gewicht : 0.01000kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 15963019

Menge Preis
1 128.22 CHF / 5 Mikrogramm
10 117.77 CHF / 5 Mikrogramm
Voraussichtliches Versanddatum: 10-11-2021

Zum Warenkorb hinzufügen


Beschreibung

Beschreibung

Spezifikation

Spezifikation

RAP Protein
5 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Rat
His
The protein (1 mg/ml) was lyophilized after from a sterile solution containing TBS pH 7.5, 0.1% BSA and 0.09% NaN3.
Greater than 95.0% as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MAPLRDRVSTLPRLQLLVLLLLPLLLVPQPIAGHGGKYSREKNEPEMAAKRESGEEFRME KLNQLWEKAKRLHLSPVRLAELHSDLKIQERDELNWKKLKVEGLDGDGEKEAKLVHNLNV ILARYGLDGRKDTQTVHSNALNEDTQDELGDPRLEKLWHKAKTSGKFSSEELDKLWREFL HYKEKIHEYNVLLDTLSRAEEGYENLLSPSDMTHIKSDTLASKHSELKDRLRSINQGLDR LRKVSHQGYGPATEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQ LEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate