missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant other protein 1

A cDNA sequence encoding the Protein G was constructed and used to recombinantly synthesize the protein.

Marke:  enQuireBio™ QP13162-100mg

Additional Details : Gewicht : 0.01000kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 15982689

  • 695.00 CHF / 100 Milligramm


Verfügbar ab
30-10-2020
Zum Warenkorb hinzufügen

Spezifikation

Spezifikation

protein 1
100 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Other
Untagged
Lyophilized white powder containing no additives.
>96% as determined by SDS-PAGE and RP-HPLC.
Research Use Only
Recombinant Protein
E. coli
LPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Videos
Dokumentation